PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN11601.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 332aa    MW: 36671.1 Da    PI: 8.1343
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN11601.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.75.4e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd +lv +++++G+g+W++++++ g+ R+ k+c++rw +yl
       KHN11601.1 14 KGPWTPEEDIILVSYIQEHGPGNWRAVPAKTGLSRCSKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.91.5e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T++E++ ++++  +lG++ W++Ia++++  Rt++++k++w+++l
       KHN11601.1  67 RGNFTEQEEKMIIHLQDLLGNR-WAAIASYLP-QRTDNDIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.605.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129425.752965IPR017930Myb domain
SuperFamilySSF466892.15E-3111108IPR009057Homeodomain-like
SMARTSM007172.2E-151363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001672.35E-111661No hitNo description
Gene3DG3DSA:1.10.10.601.3E-2465117IPR009057Homeodomain-like
PROSITE profilePS5129420.34566116IPR017930Myb domain
SMARTSM007174.0E-1566114IPR001005SANT/Myb domain
PfamPF002499.8E-1567112IPR001005SANT/Myb domain
CDDcd001671.46E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0001666Biological Processresponse to hypoxia
GO:0009617Biological Processresponse to bacterium
GO:0009626Biological Processplant-type hypersensitive response
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042761Biological Processvery long-chain fatty acid biosynthetic process
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 332 aa     Download sequence    Send to blast
MGRPPCCDKE GVKKGPWTPE EDIILVSYIQ EHGPGNWRAV PAKTGLSRCS KSCRLRWTNY  60
LRPGIKRGNF TEQEEKMIIH LQDLLGNRWA AIASYLPQRT DNDIKNYWNT HLRKKLKKMQ  120
AGGEGGSFGE GFSASRQIPR GQWERRLQTD IQMAKRALSE ALSPEKKPSC LSASNSNPSD  180
SSSSFSSTKP TTTQSVCYVS SADNIARMLK GWMKNPPKSS RTNSSMTQNS FNNLAGADTA  240
SSSGAKGPLS SAELSENNFE SLFDFDQSLE SSNSDQFSQS LSPEATVLQD ESKPDINIAA  300
EIMPFSLLEK WLLDEAGCQE KLVGCCGDAK FF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-271411627128MYB TRANSFORMING PROTEIN
1mse_C8e-28141164105C-Myb DNA-Binding Domain
1msf_C8e-28141164105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00386DAPTransfer from AT3G28910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT0312040.0KT031204.1 Glycine max clone HN_CCL_69 MYB/HD-like transcription factor (Glyma18g49360.1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003534453.10.0PREDICTED: myb-related protein 306
SwissprotP813921e-112MYB06_ANTMA; Myb-related protein 306
TrEMBLA0A0B2PQB00.0A0A0B2PQB0_GLYSO; Myb-related protein 306
STRINGGLYMA09G37340.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF101634115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G28910.11e-103myb domain protein 30
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]